PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_139710_fhny.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 28066.7 Da    PI: 8.1919
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_139710_fhny.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Bv6_139710_fhny.t1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                        79***********************************************96 PP

2K-box99.54.9e-33821739100
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         + ++++e+++qe+ kLk++++ Lqr+qR+llGedL++Ls keL+qLe+qL+ksl++iRs K++++l+q+ +lq+ke++l e n+aL++kle
  Bv6_139710_fhny.t1  82 QPSKETENSYQEYLKLKAKVDVLQRNQRNLLGEDLSELSTKELEQLEHQLDKSLRQIRSIKTQYMLDQLADLQRKEEMLLESNRALKSKLE 172
                         567899***********************************************************************************98 PP

               K-box 100 e 100
                         e
  Bv6_139710_fhny.t1 173 E 173
                         7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002657.53E-45278No hitNo description
SuperFamilySSF554553.27E-34285IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.7E-2783171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.76987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMAKTLERY QRCSYGALEA SQPSKETENS YQEYLKLKAK VDVLQRNQRN LLGEDLSELS  120
TKELEQLEHQ LDKSLRQIRS IKTQYMLDQL ADLQRKEEML LESNRALKSK LEETCASLRQ  180
NWEAEPQNAP PTYVRQPAEG FFEPLPCNNN SLHIGYNAVT QDHLNNATTS THNENSFTPT  240
WML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A4e-32751711101Developmental protein SEPALLATA 3
4ox0_B4e-32751711101Developmental protein SEPALLATA 3
4ox0_C4e-32751711101Developmental protein SEPALLATA 3
4ox0_D4e-32751711101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1359626e-53AF135962.1 Cucumis sativus CAGL2 (CAGL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681125.10.0PREDICTED: MADS-box protein CMB1-like
SwissprotQ396851e-139CMB1_DIACA; MADS-box protein CMB1
TrEMBLA0A0J8C9M10.0A0A0J8C9M1_BETVU; Uncharacterized protein
STRINGVIT_01s0011g00110.t011e-122(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.11e-103MIKC_MADS family protein